Class b: All beta proteins [48724] (180 folds) |
Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.4: dUTPase-like [51283] (2 families) forms tight trimer through an additional beta-sheet in each subunit subunit beta-sheets are orthogonally packed around the three-fold axis |
Family b.85.4.0: automated matches [191644] (1 protein) not a true family |
Protein automated matches [191182] (20 species) not a true protein |
Species Paramecium bursaria chlorella virus il3a [TaxId:46019] [255769] (3 PDB entries) |
Domain d3c3ic_: 3c3i C: [245456] automated match to d3ehwa_ complexed with dud, mg |
PDB Entry: 3c3i (more details), 3 Å
SCOPe Domain Sequences for d3c3ic_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c3ic_ b.85.4.0 (C:) automated matches {Paramecium bursaria chlorella virus il3a [TaxId: 46019]} ssllvkklvesattpmrgsegaagydissvedvvvpamgriavstgisirvpdgtygria prsglaykygidvlagvidsdyrgevkvilyntterdyiikkgdriaqlileqivtpgva vvldlsdtargsggfg
Timeline for d3c3ic_: