SCOPe 2.08: Domain d3c20b1: 3c20 B:2-303

Lineage for d3c20b1 (3c20 B:2-303)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
   3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest

4. Superfamily c.73.1: Carbamate kinase-like [53633] (4 families)
   the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase

5. Family c.73.1.3: PyrH-like [142721] (4 proteins)
   part of Pfam PF00696

6. Protein automated matches [190400] (4 species)
   not a true protein

7. Species Methanocaldococcus jannaschii [TaxId:2190] [255767] (3 PDB entries)

8. Domain d3c20b1: 3c20 B:2-303 [245443]
   Other proteins in same PDB: d3c20a2, d3c20a3, d3c20b2, d3c20b3
   automated match to d2hmfa1
   complexed with asp, fmt

Details for d3c20b1

PDB Entry: 3c20, 2.7 Å

PDB Description: Crystal Structure of Threonine-sensitive Aspartokinase from Methanococcus jannaschii with L-aspartate

PDB Compounds: (B:) Probable aspartokinase

SCOPe Domain Sequences for d3c20b1:

Sequence; same for both SEQRES and ATOM records:

>d3c20b1 c.73.1.3 (B:2-303) automated matches {Methanocaldococcus jannaschii [TaxId: 2190]}
ttvmkfggtsvgsgerirhvakivtkrkkedddvvvvvsamsevtnalveisqqaldvrd
iakvgdfikfirekhykaieeaikseeikeevkkiidsrieelekvligvaylgeltpks
rdyilsfgerlsspilsgairdlgeksialeggeagiitdnnfgsarvkrlevkerllpl
lkegiipvvtgfigtteegyittlgrggsdysaaligygldadiieiwtdvsgvyttdpr
lvptarripklsyieamelayfgakvlhprtiepamekgipilvkntfepesegtlitnd
me

Timeline for d3c20b1:

• d3c20b1 first appeared in SCOPe 2.04
  
• d3c20b1 appears in SCOPe 2.07