Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.73: Carbamate kinase-like [53632] (1 superfamily) 3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest |
Superfamily c.73.1: Carbamate kinase-like [53633] (4 families) the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase |
Family c.73.1.3: PyrH-like [142721] (4 proteins) part of Pfam PF00696 |
Protein automated matches [190400] (4 species) not a true protein |
Species Methanocaldococcus jannaschii [TaxId:2190] [255767] (3 PDB entries) |
Domain d3c1md1: 3c1m D:2-303 [245421] Other proteins in same PDB: d3c1ma2, d3c1ma3, d3c1mb2, d3c1mb3, d3c1mc2, d3c1mc3, d3c1md2, d3c1md3 automated match to d2hmfa1 complexed with anp, asp, fmt, mg |
PDB Entry: 3c1m (more details), 2.3 Å
SCOPe Domain Sequences for d3c1md1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c1md1 c.73.1.3 (D:2-303) automated matches {Methanocaldococcus jannaschii [TaxId: 2190]} ttvmkfggtsvgsgerirhvakivtkrkkedddvvvvvsamsevtnalveisqqaldvrd iakvgdfikfirekhykaieeaikseeikeevkkiidsrieelekvligvaylgeltpks rdyilsfgerlsspilsgairdlgeksialeggeagiitdnnfgsarvkrlevkerllpl lkegiipvvtgfigtteegyittlgrggsdysaaligygldadiieiwtdvsgvyttdpr lvptarripklsyieamelayfgakvlhprtiepamekgipilvkntfepesegtlitnd me
Timeline for d3c1md1: