Lineage for d3c1md1 (3c1m D:2-303)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2905127Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
    3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest
  4. 2905128Superfamily c.73.1: Carbamate kinase-like [53633] (4 families) (S)
    the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase
  5. 2905205Family c.73.1.3: PyrH-like [142721] (4 proteins)
    part of Pfam PF00696
  6. 2905248Protein automated matches [190400] (4 species)
    not a true protein
  7. 2905262Species Methanocaldococcus jannaschii [TaxId:2190] [255767] (3 PDB entries)
  8. 2905268Domain d3c1md1: 3c1m D:2-303 [245421]
    Other proteins in same PDB: d3c1ma2, d3c1ma3, d3c1mb2, d3c1mb3, d3c1mc2, d3c1mc3, d3c1md2, d3c1md3
    automated match to d2hmfa1
    complexed with anp, asp, fmt, mg

Details for d3c1md1

PDB Entry: 3c1m (more details), 2.3 Å

PDB Description: cyrstal structure of threonine-sensitive aspartokinase from methanococcus jannaschii with mgamp-pnp and l-aspartate
PDB Compounds: (D:) Probable aspartokinase

SCOPe Domain Sequences for d3c1md1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c1md1 c.73.1.3 (D:2-303) automated matches {Methanocaldococcus jannaschii [TaxId: 2190]}
ttvmkfggtsvgsgerirhvakivtkrkkedddvvvvvsamsevtnalveisqqaldvrd
iakvgdfikfirekhykaieeaikseeikeevkkiidsrieelekvligvaylgeltpks
rdyilsfgerlsspilsgairdlgeksialeggeagiitdnnfgsarvkrlevkerllpl
lkegiipvvtgfigtteegyittlgrggsdysaaligygldadiieiwtdvsgvyttdpr
lvptarripklsyieamelayfgakvlhprtiepamekgipilvkntfepesegtlitnd
me

SCOPe Domain Coordinates for d3c1md1:

Click to download the PDB-style file with coordinates for d3c1md1.
(The format of our PDB-style files is described here.)

Timeline for d3c1md1: