SCOPe 2.04: Domain d3bx3b_: 3bx3 B:

Lineage for d3bx3b_ (3bx3 B:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.1: ARM repeat [48371] (26 families)

5. Family a.118.1.0: automated matches [191340] (1 protein)
   not a true family

6. Protein automated matches [190220] (10 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [186980] (6 PDB entries)

8. Domain d3bx3b_: 3bx3 B: [245397]
   automated match to d3q0mb_
   protein/RNA complex; complexed with so4; mutant

Details for d3bx3b_

PDB Entry: 3bx3, 3 Å

PDB Description: puf4 t650c/c724r mutant bound to cox17 rna 3' utr recognition sequence

PDB Compounds: (B:) Protein PUF4

SCOPe Domain Sequences for d3bx3b_:

Sequence; same for both SEQRES and ATOM records:

>d3bx3b_ a.118.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dilgskaadaifeetkdytvelmtdsfgnyliqklleevtteqrivltkissphfveisl
nphgcralqklieciktdeeaqivvdslrpytvqlskdlngnhviqkclqrlkpenfqfi
fdaisdscidiathrhgcrvlqrcldhgtteqcdnlcdkllalvdkltldpfgnyvvqyi
itkeaeknkydythkivhllkpraielsihkfgsnviekilktaivsepmileilnngge
tgiqsllndsygnyvlqtaldishkqndylykrlseivapllvgpirntphgkriigmlh

Timeline for d3bx3b_:

• d3bx3b_ is new in SCOPe 2.04-stable
  
• d3bx3b_ appears in SCOPe 2.05
  
• d3bx3b_ appears in the current release, SCOPe 2.08