SCOPe 2.06: Domain d3bsha2: 3bsh A:348-404

Lineage for d3bsha2 (3bsh A:348-404)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.0: automated matches [227134] (1 protein)
   not a true family

6. Protein automated matches [226835] (34 species)
   not a true protein

7. Species Barley (Hordeum vulgare) [TaxId:4513] [255765] (2 PDB entries)

8. Domain d3bsha2: 3bsh A:348-404 [245395]
   Other proteins in same PDB: d3bsha1
   automated match to d1ht6a1
   complexed with bgc, ca; mutant

Details for d3bsha2

PDB Entry: 3bsh, 3 Å

PDB Description: barley alpha-amylase isozyme 1 (amy1) double mutant y105a/y380a in complex with inhibitor acarbose

PDB Compounds: (A:) Alpha-amylase type A isozyme

SCOPe Domain Sequences for d3bsha2:

Sequence; same for both SEQRES and ATOM records:

>d3bsha2 b.71.1.0 (A:348-404) automated matches {Barley (Hordeum vulgare) [TaxId: 4513]}
itatsalkilmhegdayvaeidgkvvvkigsradvgavipagfvtsahgndyavwek

Timeline for d3bsha2:

• d3bsha2 first appeared in SCOPe 2.04
  
• d3bsha2 appears in SCOPe 2.05
  
• d3bsha2 appears in SCOPe 2.07
  
• d3bsha2 appears in the current release, SCOPe 2.08