Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins) members of the family may contain various insert subdomains in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain |
Protein automated matches [190099] (25 species) not a true protein |
Species Barley (Hordeum vulgare) [TaxId:4513] [255684] (8 PDB entries) |
Domain d3bsha1: 3bsh A:1-347 [245394] Other proteins in same PDB: d3bsha2 automated match to d1ht6a2 complexed with bgc, ca; mutant |
PDB Entry: 3bsh (more details), 3 Å
SCOPe Domain Sequences for d3bsha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bsha1 c.1.8.1 (A:1-347) automated matches {Barley (Hordeum vulgare) [TaxId: 4513]} hqvlfqgfnweswkqsggwynmmmgkvddiaaagvthvwlpppshsvsnegympgrlydi daskygnaaelksligalhgkgvqaiadivinhrcadykdsrgiacifeggtsdgrldwg phmicrddtkysdgtanldtgadfaaapdidhlndrvqrelkewllwlksdlgfdawrld fargyspemakvyidgtspslavaevwdnmatggdgkpnydqdahrqnlvnwvdkvggaa sagmvfdfttkgilnaavegelwrlidpqgkapgvmgwwpakavtfvdnhdtgstqamwp fpsdkvmqgyayilthpgipcifydhffnwgfkdqiaalvairkrng
Timeline for d3bsha1: