Lineage for d3bsha1 (3bsh A:1-347)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1568602Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1568603Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 1569091Protein automated matches [190099] (19 species)
    not a true protein
  7. 1569109Species Barley (Hordeum vulgare) [TaxId:4513] [255684] (8 PDB entries)
  8. 1569117Domain d3bsha1: 3bsh A:1-347 [245394]
    Other proteins in same PDB: d3bsha2
    automated match to d1ht6a2
    complexed with bgc, ca; mutant

Details for d3bsha1

PDB Entry: 3bsh (more details), 3 Å

PDB Description: barley alpha-amylase isozyme 1 (amy1) double mutant y105a/y380a in complex with inhibitor acarbose
PDB Compounds: (A:) Alpha-amylase type A isozyme

SCOPe Domain Sequences for d3bsha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bsha1 c.1.8.1 (A:1-347) automated matches {Barley (Hordeum vulgare) [TaxId: 4513]}
hqvlfqgfnweswkqsggwynmmmgkvddiaaagvthvwlpppshsvsnegympgrlydi
daskygnaaelksligalhgkgvqaiadivinhrcadykdsrgiacifeggtsdgrldwg
phmicrddtkysdgtanldtgadfaaapdidhlndrvqrelkewllwlksdlgfdawrld
fargyspemakvyidgtspslavaevwdnmatggdgkpnydqdahrqnlvnwvdkvggaa
sagmvfdfttkgilnaavegelwrlidpqgkapgvmgwwpakavtfvdnhdtgstqamwp
fpsdkvmqgyayilthpgipcifydhffnwgfkdqiaalvairkrng

SCOPe Domain Coordinates for d3bsha1:

Click to download the PDB-style file with coordinates for d3bsha1.
(The format of our PDB-style files is described here.)

Timeline for d3bsha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3bsha2