SCOPe 2.06: Domain d3brgc1: 3brg C:205-359

Lineage for d3brgc1 (3brg C:205-359)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.7: DNA-binding protein LAG-1 (CSL) [110217] (2 families)
   contains rudiment hairpin triplet lacking one hairpin
   automatically mapped to Pfam PF09270

5. Family b.42.7.0: automated matches [254285] (1 protein)
   not a true family

6. Protein automated matches [254666] (1 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [255764] (1 PDB entry)

8. Domain d3brgc1: 3brg C:205-359 [245392]
   Other proteins in same PDB: d3brgc2
   automated match to d3brda3
   protein/DNA complex; complexed with edo

Details for d3brgc1

PDB Entry: 3brg, 2.2 Å

PDB Description: csl (rbp-jk) bound to dna

PDB Compounds: (C:) Recombining binding protein suppressor of hairless

SCOPe Domain Sequences for d3brgc1:

Sequence, based on SEQRES records:

>d3brgc1 b.42.7.0 (C:205-359) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
lciasgtkvalfnrlrsqtvstrylhveggnfhassqqwgafyihlldddesegeeftvr
dgyihygqtvklvcsvtgmalprliirkvdkqtalldaddpvsqlhkcafylkdtermyl
clsqeriiqfqatpcpkeqnkemindgaswtiist

Sequence, based on observed residues (ATOM records):

>d3brgc1 b.42.7.0 (C:205-359) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
lciasgtkvalfnrlrsqtvstrylhveggnfhassqqwgafyihlldddetvrdgyihy
gqtvklvcsvtgmalprliirkvdkqtalldaddpvsqlhkcafylkdtermylclsqer
iiqfqatpcpkeqnkemindgaswtiist

Timeline for d3brgc1:

• d3brgc1 first appeared in SCOPe 2.04
  
• d3brgc1 appears in SCOPe 2.05
  
• d3brgc1 appears in SCOPe 2.07
  
• d3brgc1 appears in the current release, SCOPe 2.08