SCOPe 2.06: Domain d3bpoa_: 3bpo A:

Lineage for d3bpoa_ (3bpo A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)

6. Protein Interleukin-13 (IL-13) [63532] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [63533] (12 PDB entries)

8. Domain d3bpoa_: 3bpo A: [245389]
   Other proteins in same PDB: d3bpob1, d3bpob2, d3bpob3
   automated match to d1ik0a_
   complexed with nag

Details for d3bpoa_

PDB Entry: 3bpo, 3 Å

PDB Description: crystal structure of the il13-il4r-il13ra ternary complex

PDB Compounds: (A:) Interleukin 13

SCOPe Domain Sequences for d3bpoa_:

Sequence, based on SEQRES records:

>d3bpoa_ a.26.1.2 (A:) Interleukin-13 (IL-13) {Human (Homo sapiens) [TaxId: 9606]}
gpvppstalrelieelvnitqnqkaplcngsmvwsinlttagmycaaleslinvsgcsai
ektqrmlsgfcphkvsagqfsslhvrdtkievaqfvkdlllhlkklfregqf

Sequence, based on observed residues (ATOM records):

>d3bpoa_ a.26.1.2 (A:) Interleukin-13 (IL-13) {Human (Homo sapiens) [TaxId: 9606]}
gpvppstalrelieelvnitqaplcngsmvwsinagmycaaleslinvsgcsaiektqrm
lsgfcphslhvrdtkievaqfvkdlllhlkklfregqf

Timeline for d3bpoa_:

• d3bpoa_ first appeared in SCOPe 2.04
  
• d3bpoa_ appears in SCOPe 2.05
  
• d3bpoa_ appears in SCOPe 2.07
  
• d3bpoa_ appears in the current release, SCOPe 2.08