Lineage for d3bnwb_ (3bnw B:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1543994Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1544703Superfamily b.43.5: Riboflavin kinase-like [82114] (3 families) (S)
  5. 1544745Family b.43.5.0: automated matches [227257] (1 protein)
    not a true family
  6. 1544746Protein automated matches [227042] (2 species)
    not a true protein
  7. 1544751Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [255763] (1 PDB entry)
  8. 1544752Domain d3bnwb_: 3bnw B: [245386]
    automated match to d1nb9a_

Details for d3bnwb_

PDB Entry: 3bnw (more details), 2.4 Å

PDB Description: Crystal structure of riboflavin kinase from Trypanosoma brucei
PDB Compounds: (B:) Riboflavin kinase, putative

SCOPe Domain Sequences for d3bnwb_:

Sequence, based on SEQRES records: (download)

>d3bnwb_ b.43.5.0 (B:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
gsfqpfflrgkvvhgkgrggsqlgfptanigldkdvmeclqpyknlvvygwgtvsqvpgk
eresfgpypfaasigfnmqfdektltvepyflhefgwdfygavvkiivlgeirsmgsfhs
lqalvdtiksdvqftrdmlqkpqlqefsrhslfespsstipyfedlp

Sequence, based on observed residues (ATOM records): (download)

>d3bnwb_ b.43.5.0 (B:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
gsfqpfflrgkvvhgsqlgfptanigldkdvmeclqpyknlvvygwgtvsqvpgkeresf
gpypfaasigfektltvepyflhefgwdfygavvkiivlgeirsmgsfhslqalvdtiks
dvqftrdmlqkpqlqefsrhslfespsstipyfedlp

SCOPe Domain Coordinates for d3bnwb_:

Click to download the PDB-style file with coordinates for d3bnwb_.
(The format of our PDB-style files is described here.)

Timeline for d3bnwb_: