SCOPe 2.08: Domain d3bnwb_: 3bnw B:

Lineage for d3bnwb_ (3bnw B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.5: Riboflavin kinase-like [82114] (3 families)

5. Family b.43.5.0: automated matches [227257] (1 protein)
   not a true family

6. Protein automated matches [227042] (2 species)
   not a true protein

7. Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [255763] (1 PDB entry)

8. Domain d3bnwb_: 3bnw B: [245386]
   Other proteins in same PDB: d3bnwa2
   automated match to d1nb9a_

Details for d3bnwb_

PDB Entry: 3bnw, 2.4 Å

PDB Description: Crystal structure of riboflavin kinase from Trypanosoma brucei

PDB Compounds: (B:) Riboflavin kinase, putative

SCOPe Domain Sequences for d3bnwb_:

Sequence, based on SEQRES records:

>d3bnwb_ b.43.5.0 (B:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
gsfqpfflrgkvvhgkgrggsqlgfptanigldkdvmeclqpyknlvvygwgtvsqvpgk
eresfgpypfaasigfnmqfdektltvepyflhefgwdfygavvkiivlgeirsmgsfhs
lqalvdtiksdvqftrdmlqkpqlqefsrhslfespsstipyfedlp

Sequence, based on observed residues (ATOM records):

>d3bnwb_ b.43.5.0 (B:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
gsfqpfflrgkvvhgsqlgfptanigldkdvmeclqpyknlvvygwgtvsqvpgkeresf
gpypfaasigfektltvepyflhefgwdfygavvkiivlgeirsmgsfhslqalvdtiks
dvqftrdmlqkpqlqefsrhslfespsstipyfedlp

Timeline for d3bnwb_:

• d3bnwb_ first appeared in SCOPe 2.04
  
• d3bnwb_ appears in SCOPe 2.07