SCOPe 2.06: Domain d1gfda1: 1gfd A:3-59

Lineage for d1gfda1 (1gfd A:3-59)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.1: SH3-domain [50045] (40 proteins)

6. Protein Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains [50070] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50071] (6 PDB entries)

8. Domain d1gfda1: 1gfd A:3-59 [24538]
   Other proteins in same PDB: d1gfda2
   C-terminal domain

Details for d1gfda1

PDB Entry: 1gfd

PDB Description: solution structure and ligand-binding site of the c-terminal sh3 domain of grb2

PDB Compounds: (A:) Growth factor receptor-bound protein 2

SCOPe Domain Sequences for d1gfda1:

Sequence; same for both SEQRES and ATOM records:

>d1gfda1 b.34.2.1 (A:3-59) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]}
tyvqalfdfdpqedgelgfrrgdfihvmdnsdpnwwkgachgqtgmfprnyvtpvnr

Timeline for d1gfda1:

• d1gfda1 first appeared (with stable ids) in SCOP 1.55, called d1gfd__
  
• d1gfda1 was called d1gfda_ in SCOPe 2.05
  
• d1gfda1 appears in SCOPe 2.07
  
• d1gfda1 appears in the current release, SCOPe 2.08