Lineage for d3bgfc2 (3bgf C:108-211)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1517226Protein automated matches [190374] (9 species)
    not a true protein
  7. 1517994Species Mouse (Mus musculus) [TaxId:10090] [224855] (343 PDB entries)
  8. 1518417Domain d3bgfc2: 3bgf C:108-211 [245372]
    Other proteins in same PDB: d3bgfa_, d3bgfc1, d3bgfl1, d3bgfs_
    automated match to d2fd6l2

Details for d3bgfc2

PDB Entry: 3bgf (more details), 3 Å

PDB Description: x-ray crystal structure of the sars coronavirus spike receptor binding domain in complex with f26g19 fab
PDB Compounds: (C:) F26G19 Fab

SCOPe Domain Sequences for d3bgfc2:

Sequence, based on SEQRES records: (download)

>d3bgfc2 b.1.1.2 (C:108-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

Sequence, based on observed residues (ATOM records): (download)

>d3bgfc2 b.1.1.2 (C:108-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyehnsytceathktstspivksfnr

SCOPe Domain Coordinates for d3bgfc2:

Click to download the PDB-style file with coordinates for d3bgfc2.
(The format of our PDB-style files is described here.)

Timeline for d3bgfc2: