Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (9 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [224855] (343 PDB entries) |
Domain d3bgfc2: 3bgf C:108-211 [245372] Other proteins in same PDB: d3bgfa_, d3bgfc1, d3bgfl1, d3bgfs_ automated match to d2fd6l2 |
PDB Entry: 3bgf (more details), 3 Å
SCOPe Domain Sequences for d3bgfc2:
Sequence, based on SEQRES records: (download)
>d3bgfc2 b.1.1.2 (C:108-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfnr
>d3bgfc2 b.1.1.2 (C:108-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyehnsytceathktstspivksfnr
Timeline for d3bgfc2:
View in 3D Domains from other chains: (mouse over for more information) d3bgfa_, d3bgfl1, d3bgfl2, d3bgfs_ |