Lineage for d3bgfa_ (3bgf A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2242618Fold d.318: SARS receptor-binding domain-like [143586] (1 superfamily)
    core: 3 layers, a/b/a; antiparallel beta-sheet of 5 strands, order 13542
  4. 2242619Superfamily d.318.1: SARS receptor-binding domain-like [143587] (1 family) (S)
    automatically mapped to Pfam PF09408
  5. 2242620Family d.318.1.1: SARS receptor-binding domain-like [143588] (2 proteins)
    part of PfamB PB000266
  6. 2242621Protein Spike protein S1 [143589] (1 species)
  7. 2242622Species SARS coronavirus [TaxId:227859] [143590] (8 PDB entries)
    Uniprot P59594 320-502! Uniprot P59594 321-512! Uniprot P59594 323-502
  8. 2242630Domain d3bgfa_: 3bgf A: [245370]
    Other proteins in same PDB: d3bgfc1, d3bgfc2, d3bgfl1, d3bgfl2
    automated match to d2ghwa_

Details for d3bgfa_

PDB Entry: 3bgf (more details), 3 Å

PDB Description: x-ray crystal structure of the sars coronavirus spike receptor binding domain in complex with f26g19 fab
PDB Compounds: (A:) Spike protein S1

SCOPe Domain Sequences for d3bgfa_:

Sequence, based on SEQRES records: (download)

>d3bgfa_ d.318.1.1 (A:) Spike protein S1 {SARS coronavirus [TaxId: 227859]}
cpfgevfnatkfpsvyawerkkisncvadysvlynstffstfkcygvsatklndlcfsnv
yadsfvvkgddvrqiapgqtgviadynyklpddfmgcvlawntrnidatstgnynykyry
lrhgklrpferdisnvpfspdgkpctppalncywplndygfytttgigyqpyrvvvlsfe

Sequence, based on observed residues (ATOM records): (download)

>d3bgfa_ d.318.1.1 (A:) Spike protein S1 {SARS coronavirus [TaxId: 227859]}
cpfgevfnatkfpsvyawerkkisncvadysvlstffstfkcygvsatklndlcfsnvya
dsfvvkgddvrqiapgqtgviadynyklpddfmgcvlawntrnidatstgnynykyrylr
hgklrpferdisnvpfspdgkpctppalncywplndygfytttgigyqpyrvvvlsfe

SCOPe Domain Coordinates for d3bgfa_:

Click to download the PDB-style file with coordinates for d3bgfa_.
(The format of our PDB-style files is described here.)

Timeline for d3bgfa_: