SCOPe 2.04: Domain d3azvb2: 3azv B:1077-1284

Lineage for d3azvb2 (3azv B:1077-1284)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.4: STI-like [50386] (3 families)

5. Family b.42.4.0: automated matches [191368] (1 protein)
   not a true family

6. Protein automated matches [190445] (5 species)
   not a true protein

7. Species Clostridium botulinum [TaxId:1491] [225676] (19 PDB entries)

8. Domain d3azvb2: 3azv B:1077-1284 [245306]
   Other proteins in same PDB: d3azva1, d3azvb1
   automated match to d3r4sa2
   complexed with so4

Details for d3azvb2

PDB Entry: 3azv, 3.1 Å

PDB Description: crystal structure of the receptor binding domain

PDB Compounds: (B:) D/C mosaic neurotoxin

SCOPe Domain Sequences for d3azvb2:

Sequence; same for both SEQRES and ATOM records:

>d3azvb2 b.42.4.0 (B:1077-1284) automated matches {Clostridium botulinum [TaxId: 1491]}
ddkdinilfnslqytnvvkdywgndlrydkeyyminvnymnrymskkgngivfntrknnn
dfnegykiiikrirgntndtrvrgenvlyfnttidnkqyslgmykpsrnlgtdlvplgal
dqpmdeirkygsfiiqpcntfdyyasqlflssnattnrlgilsigsysfklgddywfnhe
ylipvikiehyaslleststhwvfvpas

Timeline for d3azvb2:

• d3azvb2 is new in SCOPe 2.04-stable
  
• d3azvb2 appears in SCOPe 2.05
  
• d3azvb2 appears in the current release, SCOPe 2.08