Class b: All beta proteins [48724] (180 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.0: automated matches [191502] (1 protein) not a true family |
Protein automated matches [190824] (31 species) not a true protein |
Species Neisseria gonorrhoeae [TaxId:242231] [255756] (4 PDB entries) |
Domain d3ay2a_: 3ay2 A: [245265] automated match to d1rkra_ complexed with gol, so4, zn |
PDB Entry: 3ay2 (more details), 1.9 Å
SCOPe Domain Sequences for d3ay2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ay2a_ b.6.1.0 (A:) automated matches {Neisseria gonorrhoeae [TaxId: 242231]} ncaatvesndnmqfntkdiqvskackeftitlkhtgtqpkasmghnlviakaedmdgvfk dgvgaadtdyvkpddarvvahtkligggeessltldpakladgdykfactfpghgalmng kvtlvd
Timeline for d3ay2a_: