Lineage for d1srl__ (1srl -)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13047Fold b.34: SH3-like barrel [50036] (7 superfamilies)
  4. 13067Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 13068Family b.34.2.1: SH3-domain [50045] (16 proteins)
  6. 13108Protein c-src tyrosine kinase [50064] (3 species)
  7. 13112Species Chicken (Gallus gallus) [TaxId:9031] [50066] (9 PDB entries)
  8. 13121Domain d1srl__: 1srl - [24525]

Details for d1srl__

PDB Entry: 1srl (more details)

PDB Description: 1h and 15n assignments and secondary structure of the src sh3 domain
PDB Compounds: ( :)

SCOP Domain Sequences for d1srl__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1srl__ b.34.2.1 (-) c-src tyrosine kinase {Chicken (Gallus gallus)}
tfvalydyesrtetdlsfkkgerlqivnntegdwwlahslttgqtgyipsnyvaps

SCOP Domain Coordinates for d1srl__:

Click to download the PDB-style file with coordinates for d1srl__.
(The format of our PDB-style files is described here.)

Timeline for d1srl__: