SCOPe 2.06: Domain d3aucb_: 3auc B:

Lineage for d3aucb_ (3auc B:)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.8: BPTI-like [57361] (1 superfamily)
   disulfide-rich alpha+beta fold

4. Superfamily g.8.1: BPTI-like [57362] (4 families)

5. Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins)

6. Protein automated matches [190046] (4 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [186767] (13 PDB entries)

8. Domain d3aucb_: 3auc B: [245232]
   automated match to d3gymi_
   complexed with so4

Details for d3aucb_

PDB Entry: 3auc, 1.91 Å

PDB Description: A simplified BPTI variant with poly SER (C5S) amino acid tag at the c-terminus

PDB Compounds: (B:) bovine pancreatic trypsin inhibitor

SCOPe Domain Sequences for d3aucb_:

Sequence; same for both SEQRES and ATOM records:

>d3aucb_ g.8.1.1 (B:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
rpafcleppyagpgkariiryfynaaagaaqtfvyggvrakrnnfasaadalaaca

Timeline for d3aucb_:

• d3aucb_ first appeared in SCOPe 2.04
  
• d3aucb_ appears in SCOPe 2.05
  
• d3aucb_ appears in SCOPe 2.07
  
• d3aucb_ appears in the current release, SCOPe 2.08