![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily) 4 helices; irregular array, disulfide-linked |
![]() | Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (2 families) ![]() |
![]() | Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (2 proteins) |
![]() | Protein automated matches [190271] (1 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [187063] (25 PDB entries) |
![]() | Domain d3asnu_: 3asn U: [245222] Other proteins in same PDB: d3asna_, d3asnb1, d3asnb2, d3asnc_, d3asnd_, d3asne_, d3asnf_, d3asng_, d3asni_, d3asnj_, d3asnk_, d3asnl_, d3asnm_, d3asnn_, d3asno1, d3asno2, d3asnp_, d3asnq_, d3asnr_, d3asns_, d3asnt_, d3asnv_, d3asnw_, d3asnx_, d3asny_, d3asnz_ automated match to d1v54h_ complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn |
PDB Entry: 3asn (more details), 3 Å
SCOPe Domain Sequences for d3asnu_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3asnu_ a.51.1.1 (U:) automated matches {Cow (Bos taurus) [TaxId: 9913]} kiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpi swvstwddrraegtfpgki
Timeline for d3asnu_:
![]() Domains from other chains: (mouse over for more information) d3asna_, d3asnb1, d3asnb2, d3asnc_, d3asnd_, d3asne_, d3asnf_, d3asng_, d3asnh_, d3asni_, d3asnj_, d3asnk_, d3asnl_, d3asnm_, d3asnn_, d3asno1, d3asno2, d3asnp_, d3asnq_, d3asnr_, d3asns_, d3asnt_, d3asnv_, d3asnw_, d3asnx_, d3asny_, d3asnz_ |