Lineage for d3asnu_ (3asn U:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2714739Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily)
    4 helices; irregular array, disulfide-linked
  4. 2714740Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (2 families) (S)
  5. 2714741Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (2 proteins)
  6. 2714802Protein automated matches [190271] (1 species)
    not a true protein
  7. 2714803Species Cow (Bos taurus) [TaxId:9913] [187063] (26 PDB entries)
  8. 2714847Domain d3asnu_: 3asn U: [245222]
    Other proteins in same PDB: d3asna_, d3asnb1, d3asnb2, d3asnc_, d3asnd_, d3asne_, d3asnf_, d3asng_, d3asni_, d3asnj_, d3asnk_, d3asnl_, d3asnm_, d3asnn_, d3asno1, d3asno2, d3asnp_, d3asnq_, d3asnr_, d3asns_, d3asnt_, d3asnv_, d3asnw_, d3asnx_, d3asny_, d3asnz_
    automated match to d1v54h_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d3asnu_

PDB Entry: 3asn (more details), 3 Å

PDB Description: Bovine heart cytochrome C oxidase in the fully oxidized state measured at 1.7470 angstrom wavelength
PDB Compounds: (U:) Cytochrome c oxidase subunit 6B1

SCOPe Domain Sequences for d3asnu_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3asnu_ a.51.1.1 (U:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
kiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpi
swvstwddrraegtfpgki

SCOPe Domain Coordinates for d3asnu_:

Click to download the PDB-style file with coordinates for d3asnu_.
(The format of our PDB-style files is described here.)

Timeline for d3asnu_: