| Class g: Small proteins [56992] (94 folds) |
| Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.5: Rubredoxin-like [57802] (4 families) ![]() |
| Family g.41.5.3: Cytochrome c oxidase Subunit F [57818] (2 proteins) membrane-anchored rubredoxin-like domain automatically mapped to Pfam PF01215 |
| Protein Cytochrome c oxidase Subunit F [57819] (1 species) |
| Species Cow (Bos taurus) [TaxId:9913] [57820] (35 PDB entries) |
| Domain d3asns_: 3asn S: [245220] Other proteins in same PDB: d3asna_, d3asnb1, d3asnb2, d3asnc_, d3asnd_, d3asne_, d3asng_, d3asnh_, d3asni_, d3asnj_, d3asnk_, d3asnl_, d3asnm_, d3asnn_, d3asno1, d3asno2, d3asnp_, d3asnq_, d3asnr_, d3asnt_, d3asnu_, d3asnv_, d3asnw_, d3asnx_, d3asny_, d3asnz_ automated match to d3ag3f_ complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn |
PDB Entry: 3asn (more details), 3 Å
SCOPe Domain Sequences for d3asns_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3asns_ g.41.5.3 (S:) Cytochrome c oxidase Subunit F {Cow (Bos taurus) [TaxId: 9913]}
asgggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgc
iceednstviwfwlhkgeaqrcpscgthyklvphqlah
Timeline for d3asns_:
View in 3DDomains from other chains: (mouse over for more information) d3asna_, d3asnb1, d3asnb2, d3asnc_, d3asnd_, d3asne_, d3asnf_, d3asng_, d3asnh_, d3asni_, d3asnj_, d3asnk_, d3asnl_, d3asnm_, d3asnn_, d3asno1, d3asno2, d3asnp_, d3asnq_, d3asnr_, d3asnt_, d3asnu_, d3asnv_, d3asnw_, d3asnx_, d3asny_, d3asnz_ |