Lineage for d1srma_ (1srm A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2053585Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2053714Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2053715Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2053806Protein c-src protein tyrosine kinase [50064] (3 species)
  7. 2053810Species Chicken (Gallus gallus) [TaxId:9031] [50066] (10 PDB entries)
  8. 2053820Domain d1srma_: 1srm A: [24522]

Details for d1srma_

PDB Entry: 1srm (more details)

PDB Description: 1h and 15n assignments and secondary structure of the src sh3 domain
PDB Compounds: (A:) src tyrosine kinase sh3 domain

SCOPe Domain Sequences for d1srma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1srma_ b.34.2.1 (A:) c-src protein tyrosine kinase {Chicken (Gallus gallus) [TaxId: 9031]}
tfvalydyesrtetdlsfkkgerlqivnntegdwwlahslttgqtgyipsnyvaps

SCOPe Domain Coordinates for d1srma_:

Click to download the PDB-style file with coordinates for d1srma_.
(The format of our PDB-style files is described here.)

Timeline for d1srma_: