Lineage for d3asnr_ (3asn R:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2009599Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2011125Superfamily a.118.11: Cytochrome c oxidase subunit E [48479] (1 family) (S)
    automatically mapped to Pfam PF02284
  5. 2011126Family a.118.11.1: Cytochrome c oxidase subunit E [48480] (2 proteins)
  6. 2011127Protein Cytochrome c oxidase subunit E [48481] (1 species)
  7. 2011128Species Cow (Bos taurus) [TaxId:9913] [48482] (35 PDB entries)
  8. 2011179Domain d3asnr_: 3asn R: [245219]
    Other proteins in same PDB: d3asna_, d3asnb1, d3asnb2, d3asnc_, d3asnd_, d3asnf_, d3asng_, d3asnh_, d3asni_, d3asnj_, d3asnk_, d3asnl_, d3asnm_, d3asnn_, d3asno1, d3asno2, d3asnp_, d3asnq_, d3asns_, d3asnt_, d3asnu_, d3asnv_, d3asnw_, d3asnx_, d3asny_, d3asnz_
    automated match to d1ocre_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d3asnr_

PDB Entry: 3asn (more details), 3 Å

PDB Description: Bovine heart cytochrome C oxidase in the fully oxidized state measured at 1.7470 angstrom wavelength
PDB Compounds: (R:) Cytochrome c oxidase subunit 5A

SCOPe Domain Sequences for d3asnr_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3asnr_ a.118.11.1 (R:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]}
hetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlndfasa
vrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv

SCOPe Domain Coordinates for d3asnr_:

Click to download the PDB-style file with coordinates for d3asnr_.
(The format of our PDB-style files is described here.)

Timeline for d3asnr_: