![]() | Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (38 superfamilies) not a true fold |
![]() | Superfamily f.23.1: Mitochondrial cytochrome c oxidase subunit IV [81406] (1 family) ![]() automatically mapped to Pfam PF02936 |
![]() | Family f.23.1.1: Mitochondrial cytochrome c oxidase subunit IV [81405] (2 proteins) |
![]() | Protein automated matches [190270] (1 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [187062] (18 PDB entries) |
![]() | Domain d3asnq_: 3asn Q: [245218] Other proteins in same PDB: d3asna_, d3asnb1, d3asnb2, d3asnc_, d3asne_, d3asnf_, d3asng_, d3asnh_, d3asni_, d3asnj_, d3asnk_, d3asnl_, d3asnm_, d3asnn_, d3asno1, d3asno2, d3asnp_, d3asnr_, d3asns_, d3asnt_, d3asnu_, d3asnv_, d3asnw_, d3asnx_, d3asny_, d3asnz_ automated match to d1v54d_ complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn |
PDB Entry: 3asn (more details), 3 Å
SCOPe Domain Sequences for d3asnq_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3asnq_ f.23.1.1 (Q:) automated matches {Cow (Bos taurus) [TaxId: 9913]} svvksedyalpsyvdrrdyplpdvahvknlsasqkalkekekaswsslsidekvelyrlk fkesfaemnrstnewktvvgaamffigftallliwekhyvygpiphtfeeewvakqtkrm ldmkvapiqgfsakwdydknewkk
Timeline for d3asnq_:
![]() Domains from other chains: (mouse over for more information) d3asna_, d3asnb1, d3asnb2, d3asnc_, d3asnd_, d3asne_, d3asnf_, d3asng_, d3asnh_, d3asni_, d3asnj_, d3asnk_, d3asnl_, d3asnm_, d3asnn_, d3asno1, d3asno2, d3asnp_, d3asnr_, d3asns_, d3asnt_, d3asnu_, d3asnv_, d3asnw_, d3asnx_, d3asny_, d3asnz_ |