Lineage for d3asnj_ (3asn J:)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1957421Fold f.23: Single transmembrane helix [81407] (40 superfamilies)
    not a true fold
  4. 1957600Superfamily f.23.4: Mitochondrial cytochrome c oxidase subunit VIIa [81419] (1 family) (S)
    automatically mapped to Pfam PF02238
  5. 1957601Family f.23.4.1: Mitochondrial cytochrome c oxidase subunit VIIa [81418] (2 proteins)
  6. 1957602Protein Mitochondrial cytochrome c oxidase subunit VIIa [81417] (1 species)
    function unknown, probably acts as a regulator or is required for the assembly
  7. 1957603Species Cow (Bos taurus) [TaxId:9913] [81416] (26 PDB entries)
  8. 1957644Domain d3asnj_: 3asn J: [245210]
    Other proteins in same PDB: d3asna_, d3asnb1, d3asnb2, d3asnc_, d3asnd_, d3asne_, d3asnf_, d3asng_, d3asnh_, d3asni_, d3asnk_, d3asnl_, d3asnm_, d3asnn_, d3asno1, d3asno2, d3asnp_, d3asnq_, d3asnr_, d3asns_, d3asnt_, d3asnu_, d3asnv_, d3asnx_, d3asny_, d3asnz_
    automated match to d3ag3j_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d3asnj_

PDB Entry: 3asn (more details), 3 Å

PDB Description: Bovine heart cytochrome C oxidase in the fully oxidized state measured at 1.7470 angstrom wavelength
PDB Compounds: (J:) Cytochrome c oxidase subunit 7A1

SCOPe Domain Sequences for d3asnj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3asnj_ f.23.4.1 (J:) Mitochondrial cytochrome c oxidase subunit VIIa {Cow (Bos taurus) [TaxId: 9913]}
fenrvaekqklfqednglpvhlkggatdnilyrvtmtlclggtlyslyclgwasfphk

SCOPe Domain Coordinates for d3asnj_:

Click to download the PDB-style file with coordinates for d3asnj_.
(The format of our PDB-style files is described here.)

Timeline for d3asnj_: