Lineage for d1rlqc_ (1rlq C:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 165384Fold b.34: SH3-like barrel [50036] (10 superfamilies)
  4. 165426Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 165427Family b.34.2.1: SH3-domain [50045] (23 proteins)
  6. 165474Protein c-src protein tyrosine kinase [50064] (3 species)
  7. 165478Species Chicken (Gallus gallus) [TaxId:9031] [50066] (9 PDB entries)
  8. 165483Domain d1rlqc_: 1rlq C: [24521]

Details for d1rlqc_

PDB Entry: 1rlq (more details)

PDB Description: two binding orientations for peptides to src sh3 domain: development of a general model for sh3-ligand interactions

SCOP Domain Sequences for d1rlqc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rlqc_ b.34.2.1 (C:) c-src protein tyrosine kinase {Chicken (Gallus gallus)}
tfvalydyesrtetdlsfkkgerlqivnntegdwwlahslttgqtgyipsnyvaps

SCOP Domain Coordinates for d1rlqc_:

Click to download the PDB-style file with coordinates for d1rlqc_.
(The format of our PDB-style files is described here.)

Timeline for d1rlqc_: