Lineage for d1rlqc_ (1rlq C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2782862Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2782953Protein c-src protein tyrosine kinase [50064] (3 species)
  7. 2782957Species Chicken (Gallus gallus) [TaxId:9031] [50066] (28 PDB entries)
  8. 2782971Domain d1rlqc_: 1rlq C: [24521]

Details for d1rlqc_

PDB Entry: 1rlq (more details)

PDB Description: two binding orientations for peptides to src sh3 domain: development of a general model for sh3-ligand interactions
PDB Compounds: (C:) c-src tyrosine kinase sh3 domain

SCOPe Domain Sequences for d1rlqc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rlqc_ b.34.2.1 (C:) c-src protein tyrosine kinase {Chicken (Gallus gallus) [TaxId: 9031]}
tfvalydyesrtetdlsfkkgerlqivnntegdwwlahslttgqtgyipsnyvaps

SCOPe Domain Coordinates for d1rlqc_:

Click to download the PDB-style file with coordinates for d1rlqc_.
(The format of our PDB-style files is described here.)

Timeline for d1rlqc_: