Lineage for d3asnf_ (3asn F:)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1705786Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1705990Superfamily g.41.5: Rubredoxin-like [57802] (4 families) (S)
  5. 1706149Family g.41.5.3: Cytochrome c oxidase Subunit F [57818] (2 proteins)
    membrane-anchored rubredoxin-like domain
    automatically mapped to Pfam PF01215
  6. 1706150Protein Cytochrome c oxidase Subunit F [57819] (1 species)
  7. 1706151Species Cow (Bos taurus) [TaxId:9913] [57820] (25 PDB entries)
  8. 1706190Domain d3asnf_: 3asn F: [245206]
    Other proteins in same PDB: d3asna_, d3asnb1, d3asnb2, d3asnc_, d3asnd_, d3asne_, d3asng_, d3asnh_, d3asni_, d3asnj_, d3asnk_, d3asnl_, d3asnm_, d3asnn_, d3asno1, d3asno2, d3asnp_, d3asnq_, d3asnr_, d3asnt_, d3asnu_, d3asnv_, d3asnw_, d3asnx_, d3asny_, d3asnz_
    automated match to d3ag3f_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d3asnf_

PDB Entry: 3asn (more details), 3 Å

PDB Description: Bovine heart cytochrome C oxidase in the fully oxidized state measured at 1.7470 angstrom wavelength
PDB Compounds: (F:) Cytochrome c oxidase subunit 5B

SCOPe Domain Sequences for d3asnf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3asnf_ g.41.5.3 (F:) Cytochrome c oxidase Subunit F {Cow (Bos taurus) [TaxId: 9913]}
asgggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgc
iceednstviwfwlhkgeaqrcpscgthyklvphqlah

SCOPe Domain Coordinates for d3asnf_:

Click to download the PDB-style file with coordinates for d3asnf_.
(The format of our PDB-style files is described here.)

Timeline for d3asnf_: