Lineage for d3asnd_ (3asn D:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2253581Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2253582Superfamily f.23.1: Mitochondrial cytochrome c oxidase subunit IV [81406] (1 family) (S)
    automatically mapped to Pfam PF02936
  5. 2253583Family f.23.1.1: Mitochondrial cytochrome c oxidase subunit IV [81405] (2 proteins)
  6. 2253621Protein automated matches [190270] (1 species)
    not a true protein
  7. 2253622Species Cow (Bos taurus) [TaxId:9913] [187062] (19 PDB entries)
  8. 2253652Domain d3asnd_: 3asn D: [245204]
    Other proteins in same PDB: d3asna_, d3asnb1, d3asnb2, d3asnc_, d3asne_, d3asnf_, d3asng_, d3asnh_, d3asni_, d3asnj_, d3asnk_, d3asnl_, d3asnm_, d3asnn_, d3asno1, d3asno2, d3asnp_, d3asnr_, d3asns_, d3asnt_, d3asnu_, d3asnv_, d3asnw_, d3asnx_, d3asny_, d3asnz_
    automated match to d1v54d_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d3asnd_

PDB Entry: 3asn (more details), 3 Å

PDB Description: Bovine heart cytochrome C oxidase in the fully oxidized state measured at 1.7470 angstrom wavelength
PDB Compounds: (D:) Cytochrome c oxidase subunit 4 isoform 1

SCOPe Domain Sequences for d3asnd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3asnd_ f.23.1.1 (D:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
svvksedyalpsyvdrrdyplpdvahvknlsasqkalkekekaswsslsidekvelyrlk
fkesfaemnrstnewktvvgaamffigftallliwekhyvygpiphtfeeewvakqtkrm
ldmkvapiqgfsakwdydknewkk

SCOPe Domain Coordinates for d3asnd_:

Click to download the PDB-style file with coordinates for d3asnd_.
(The format of our PDB-style files is described here.)

Timeline for d3asnd_: