SCOPe 2.05: Domain d3asnd_: 3asn D:

Lineage for d3asnd_ (3asn D:)

1. Root: SCOPe 2.05

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.23: Single transmembrane helix [81407] (40 superfamilies)
   not a true fold

4. Superfamily f.23.1: Mitochondrial cytochrome c oxidase subunit IV [81406] (1 family)
   automatically mapped to Pfam PF02936

5. Family f.23.1.1: Mitochondrial cytochrome c oxidase subunit IV [81405] (2 proteins)

6. Protein automated matches [190270] (1 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [187062] (18 PDB entries)

8. Domain d3asnd_: 3asn D: [245204]
   Other proteins in same PDB: d3asna_, d3asnb1, d3asnb2, d3asnc_, d3asne_, d3asnf_, d3asng_, d3asnh_, d3asni_, d3asnj_, d3asnk_, d3asnl_, d3asnm_, d3asnn_, d3asno1, d3asno2, d3asnp_, d3asnr_, d3asns_, d3asnt_, d3asnu_, d3asnv_, d3asnw_, d3asnx_, d3asny_, d3asnz_
   automated match to d1v54d_
   complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d3asnd_

PDB Entry: 3asn, 3 Å

PDB Description: Bovine heart cytochrome C oxidase in the fully oxidized state measured at 1.7470 angstrom wavelength

PDB Compounds: (D:) Cytochrome c oxidase subunit 4 isoform 1

SCOPe Domain Sequences for d3asnd_:

Sequence; same for both SEQRES and ATOM records:

>d3asnd_ f.23.1.1 (D:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
svvksedyalpsyvdrrdyplpdvahvknlsasqkalkekekaswsslsidekvelyrlk
fkesfaemnrstnewktvvgaamffigftallliwekhyvygpiphtfeeewvakqtkrm
ldmkvapiqgfsakwdydknewkk

Timeline for d3asnd_:

• d3asnd_ first appeared in SCOPe 2.04
  
• d3asnd_ appears in SCOPe 2.06
  
• d3asnd_ appears in the current release, SCOPe 2.08