Lineage for d3argd2 (3arg D:119-246)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031996Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2031997Protein automated matches [190740] (28 species)
    not a true protein
  7. 2034475Species Mouse (Mus musculus) [TaxId:10090] [188198] (574 PDB entries)
  8. 2035421Domain d3argd2: 3arg D:119-246 [245199]
    Other proteins in same PDB: d3argb_, d3argc2
    automated match to d2nw2b2
    complexed with db6, nag

Details for d3argd2

PDB Entry: 3arg (more details), 3 Å

PDB Description: ternary crystal structure of the mouse nkt tcr-cd1d-alpha- glucosylceramide(c20:2)
PDB Compounds: (D:) Vbeta8.2

SCOPe Domain Sequences for d3argd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3argd2 b.1.1.0 (D:119-246) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgra

SCOPe Domain Coordinates for d3argd2:

Click to download the PDB-style file with coordinates for d3argd2.
(The format of our PDB-style files is described here.)

Timeline for d3argd2: