Lineage for d3apma2 (3apm A:113-293)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2768533Superfamily b.2.9: Peptidylarginine deiminase Pad4, middle domain [110083] (2 families) (S)
    automatically mapped to Pfam PF08527
  5. 2768534Family b.2.9.1: Peptidylarginine deiminase Pad4, middle domain [110084] (1 protein)
  6. 2768535Protein Peptidylarginine deiminase Pad4, middle domain [110085] (1 species)
  7. 2768536Species Human (Homo sapiens) [TaxId:9606] [110086] (17 PDB entries)
    Uniprot Q9UM07
  8. 2768547Domain d3apma2: 3apm A:113-293 [245185]
    Other proteins in same PDB: d3apma1, d3apma3
    automated match to d2dexx1

Details for d3apma2

PDB Entry: 3apm (more details), 2.5 Å

PDB Description: Crystal structure of the human SNP PAD4 protein
PDB Compounds: (A:) Protein-arginine deiminase type-4

SCOPe Domain Sequences for d3apma2:

Sequence, based on SEQRES records: (download)

>d3apma2 b.2.9.1 (A:113-293) Peptidylarginine deiminase Pad4, middle domain {Human (Homo sapiens) [TaxId: 9606]}
veislcaditrtgkvkptravkdqrtwtwgpcgqgaillvncdrdnlessamdceddevl
dsedlqdmslmtlstktpkdfftnhtlvlhvarsemdkvrvfqatrgklsskcsvvlgpk
wpshylmvpggkhnmdfyvealafpdtdfpglitltislldtsnlelpeavvfqdsvvfr
v

Sequence, based on observed residues (ATOM records): (download)

>d3apma2 b.2.9.1 (A:113-293) Peptidylarginine deiminase Pad4, middle domain {Human (Homo sapiens) [TaxId: 9606]}
veislcaditrtgkvkqrtwtwgpcgqgaillvncdrdldsedlqdmslmtlstktpkdf
ftnhtlvlhvarsemdkvrvfqatrkcsvvlgpkwpshylmvpggkhnmdfyvealafpd
tdfpglitltislldtsnlelpeavvfqdsvvfrv

SCOPe Domain Coordinates for d3apma2:

Click to download the PDB-style file with coordinates for d3apma2.
(The format of our PDB-style files is described here.)

Timeline for d3apma2: