Class b: All beta proteins [48724] (149 folds) |
Fold b.34: SH3-like barrel [50036] (15 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (1 family) |
Family b.34.2.1: SH3-domain [50045] (37 proteins) |
Protein c-src protein tyrosine kinase [50064] (3 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [50066] (9 PDB entries) |
Domain d2ptk_1: 2ptk 83-145 [24517] Other proteins in same PDB: d2ptk_2, d2ptk_3 |
PDB Entry: 2ptk (more details), 2.35 Å
SCOP Domain Sequences for d2ptk_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ptk_1 b.34.2.1 (83-145) c-src protein tyrosine kinase {Chicken (Gallus gallus)} vttfvalydyesrtetdlsfkkgerlqivnntegdwwlahslttgqtgyipsnyvapsds iqa
Timeline for d2ptk_1: