Lineage for d2ptk_1 (2ptk 83-145)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 109314Fold b.34: SH3-like barrel [50036] (9 superfamilies)
  4. 109356Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 109357Family b.34.2.1: SH3-domain [50045] (20 proteins)
  6. 109398Protein c-src tyrosine kinase [50064] (4 species)
  7. 109402Species Chicken (Gallus gallus) [TaxId:9031] [50066] (9 PDB entries)
  8. 109403Domain d2ptk_1: 2ptk 83-145 [24517]
    Other proteins in same PDB: d2ptk_2, d2ptk_3

Details for d2ptk_1

PDB Entry: 2ptk (more details), 2.35 Å

PDB Description: chicken src tyrosine kinase

SCOP Domain Sequences for d2ptk_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ptk_1 b.34.2.1 (83-145) c-src tyrosine kinase {Chicken (Gallus gallus)}
vttfvalydyesrtetdlsfkkgerlqivnntegdwwlahslttgqtgyipsnyvapsds
iqa

SCOP Domain Coordinates for d2ptk_1:

Click to download the PDB-style file with coordinates for d2ptk_1.
(The format of our PDB-style files is described here.)

Timeline for d2ptk_1: