Lineage for d2ptk_1 (2ptk 83-145)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13047Fold b.34: SH3-like barrel [50036] (7 superfamilies)
  4. 13067Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 13068Family b.34.2.1: SH3-domain [50045] (16 proteins)
  6. 13108Protein c-src tyrosine kinase [50064] (3 species)
  7. 13112Species Chicken (Gallus gallus) [TaxId:9031] [50066] (9 PDB entries)
  8. 13113Domain d2ptk_1: 2ptk 83-145 [24517]
    Other proteins in same PDB: d2ptk_2, d2ptk_3

Details for d2ptk_1

PDB Entry: 2ptk (more details), 2.35 Å

PDB Description: chicken src tyrosine kinase

SCOP Domain Sequences for d2ptk_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ptk_1 b.34.2.1 (83-145) c-src tyrosine kinase {Chicken (Gallus gallus)}
vttfvalydyesrtetdlsfkkgerlqivnntegdwwlahslttgqtgyipsnyvapsds
iqa

SCOP Domain Coordinates for d2ptk_1:

Click to download the PDB-style file with coordinates for d2ptk_1.
(The format of our PDB-style files is described here.)

Timeline for d2ptk_1: