Lineage for d1cskd_ (1csk D:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 58264Fold b.34: SH3-like barrel [50036] (9 superfamilies)
  4. 58293Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 58294Family b.34.2.1: SH3-domain [50045] (18 proteins)
  6. 58334Protein c-src tyrosine kinase [50064] (3 species)
  7. 58348Species Human (Homo sapiens) [TaxId:9606] [50065] (3 PDB entries)
  8. 58354Domain d1cskd_: 1csk D: [24516]

Details for d1cskd_

PDB Entry: 1csk (more details), 2.5 Å

PDB Description: the crystal structure of human csksh3: structural diversity near the rt-src and n-src loop

SCOP Domain Sequences for d1cskd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cskd_ b.34.2.1 (D:) c-src tyrosine kinase {Human (Homo sapiens)}
gteciakynfhgtaeqdlpfckgdvltivavtkdpnwykaknkvgregiipanyvqkr

SCOP Domain Coordinates for d1cskd_:

Click to download the PDB-style file with coordinates for d1cskd_.
(The format of our PDB-style files is described here.)

Timeline for d1cskd_: