Lineage for d1cskc_ (1csk C:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 227526Fold b.34: SH3-like barrel [50036] (12 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 227568Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 227569Family b.34.2.1: SH3-domain [50045] (24 proteins)
  6. 227637Protein Carboxyl-terminal src kinase (csk) [74654] (2 species)
  7. 227638Species Human (Homo sapiens) [TaxId:9606] [74658] (2 PDB entries)
  8. 227641Domain d1cskc_: 1csk C: [24515]

Details for d1cskc_

PDB Entry: 1csk (more details), 2.5 Å

PDB Description: the crystal structure of human csksh3: structural diversity near the rt-src and n-src loop

SCOP Domain Sequences for d1cskc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cskc_ b.34.2.1 (C:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens)}
gteciakynfhgtaeqdlpfckgdvltivavtkdpnwykaknkvgregiipanyvqkr

SCOP Domain Coordinates for d1cskc_:

Click to download the PDB-style file with coordinates for d1cskc_.
(The format of our PDB-style files is described here.)

Timeline for d1cskc_: