Lineage for d3agje2 (3agj E:228-322)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1543994Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1544037Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 1544344Family b.43.3.0: automated matches [227211] (1 protein)
    not a true family
  6. 1544345Protein automated matches [226946] (16 species)
    not a true protein
  7. 1544351Species Aeropyrum pernix [TaxId:56636] [255747] (1 PDB entry)
  8. 1544354Domain d3agje2: 3agj E:228-322 [245147]
    Other proteins in same PDB: d3agja1, d3agja3, d3agjc1, d3agjc3, d3agje1, d3agje3, d3agjg1, d3agjg3
    automated match to d1skqa1
    complexed with gtp, mg

Details for d3agje2

PDB Entry: 3agj (more details), 2.3 Å

PDB Description: Crystal structure of archaeal Pelota and GTP-bound EF1 alpha complex
PDB Compounds: (E:) Elongation factor 1-alpha

SCOPe Domain Sequences for d3agje2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3agje2 b.43.3.0 (E:228-322) automated matches {Aeropyrum pernix [TaxId: 56636]}
pvdkplripvqnvysipgagtvpvgrvetgvlrvgdkvvfmppgvvgevrsiemhyqqlq
qaepgdnigfavrgvsksdikrgdvaghldkpptv

SCOPe Domain Coordinates for d3agje2:

Click to download the PDB-style file with coordinates for d3agje2.
(The format of our PDB-style files is described here.)

Timeline for d3agje2:

  • d3agje2 is new in SCOPe 2.04-stable
  • d3agje2 does not appear in SCOPe 2.05