Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies) core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices |
Superfamily f.21.2: Fumarate reductase respiratory complex transmembrane subunits [81343] (2 families) two distinct families: in one family the common fold is contained in a single-chain subunit, in the other it is formed by two chains |
Family f.21.2.2: Succinate dehydrogenase/Fumarate reductase transmembrane subunits (SdhC/FrdC and SdhD/FrdD) [81373] (7 proteins) consists of two homologous non-identical subunits that form a heterodimer; may or may not contain heme groups |
Protein Large cytochrome binding protein CybL [254390] (1 species) |
Species Pig (Sus scrofa) [TaxId:9823] [254826] (5 PDB entries) |
Domain d3aefc_: 3aef C: [245130] Other proteins in same PDB: d3aefa1, d3aefa2, d3aefa3, d3aefb1, d3aefb2, d3aefd_ automated match to d1zoyc_ complexed with eph, f3s, fad, fes, hem, sf4 |
PDB Entry: 3aef (more details), 2.8 Å
SCOPe Domain Sequences for d3aefc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3aefc_ f.21.2.2 (C:) Large cytochrome binding protein CybL {Pig (Sus scrofa) [TaxId: 9823]} ttakeemerfwnknlgsnrplsphitiyrwslpmamsichrgtgialsagvslfglsall lpgnfeshlelvkslclgptliytakfgivfplmyhtwngirhliwdlgkgltipqltqs gvvvliltvlssvglaam
Timeline for d3aefc_: