Lineage for d1cska_ (1csk A:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 165384Fold b.34: SH3-like barrel [50036] (10 superfamilies)
  4. 165426Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 165427Family b.34.2.1: SH3-domain [50045] (23 proteins)
  6. 165492Protein Carboxyl-terminal src kinase (csk) [74654] (2 species)
  7. 165493Species Human (Homo sapiens) [TaxId:9606] [74658] (2 PDB entries)
  8. 165494Domain d1cska_: 1csk A: [24513]

Details for d1cska_

PDB Entry: 1csk (more details), 2.5 Å

PDB Description: the crystal structure of human csksh3: structural diversity near the rt-src and n-src loop

SCOP Domain Sequences for d1cska_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cska_ b.34.2.1 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens)}
gteciakynfhgtaeqdlpfckgdvltivavtkdpnwykaknkvgregiipanyvqkr

SCOP Domain Coordinates for d1cska_:

Click to download the PDB-style file with coordinates for d1cska_.
(The format of our PDB-style files is described here.)

Timeline for d1cska_: