Class a: All alpha proteins [46456] (289 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families) contains two Fe4-S4 clusters |
Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (3 proteins) |
Protein automated matches [231469] (4 species) not a true protein |
Species Pig (Sus scrofa) [TaxId:9823] [255744] (5 PDB entries) |
Domain d3ae2b2: 3ae2 B:115-247 [245120] Other proteins in same PDB: d3ae2b1, d3ae2d_ automated match to d1yq3b2 complexed with eph, f3s, fad, fes, hem, mli, sf4, sli |
PDB Entry: 3ae2 (more details), 3.1 Å
SCOPe Domain Sequences for d3ae2b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ae2b2 a.1.2.1 (B:115-247) automated matches {Pig (Sus scrofa) [TaxId: 9823]} lsnfyaqyksiepylkkkdesqegkqqylqsieerekldglyecilcaccstscpsywwn gdkylgpavlmqayrwmidsrddfteerlaklqdpfslyrchtimnctgtcpkglnpgka iaeikkmmatyke
Timeline for d3ae2b2: