Class b: All beta proteins [48724] (176 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.0: automated matches [227134] (1 protein) not a true family |
Protein automated matches [226835] (27 species) not a true protein |
Species Thermotoga maritima [TaxId:2336] [231746] (10 PDB entries) |
Domain d2zxbb2: 2zxb B:357-448 [245043] Other proteins in same PDB: d2zxba1, d2zxbb1 automated match to d2zwyb2 complexed with zxb |
PDB Entry: 2zxb (more details), 2.61 Å
SCOPe Domain Sequences for d2zxbb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zxbb2 b.71.1.0 (B:357-448) automated matches {Thermotoga maritima [TaxId: 2336]} gtsvwerccaktedgteirftrkcnrifviflgiptgekiviedlnlsagtvrhfltger lsfknvgknleitvpkklletdsitlvleave
Timeline for d2zxbb2: