SCOPe 2.04: Domain d2zxab2: 2zxa B:357-448

Lineage for d2zxab2 (2zxa B:357-448)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.0: automated matches [227134] (1 protein)
   not a true family

6. Protein automated matches [226835] (27 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:2336] [231746] (10 PDB entries)

8. Domain d2zxab2: 2zxa B:357-448 [245039]
   Other proteins in same PDB: d2zxaa1, d2zxab1
   automated match to d2zwyb2
   complexed with zxa

Details for d2zxab2

PDB Entry: 2zxa, 2.57 Å

PDB Description: alpha-l-fucosidase complexed with inhibitor, fnj-acetyl

PDB Compounds: (B:) Alpha-L-fucosidase, putative

SCOPe Domain Sequences for d2zxab2:

Sequence; same for both SEQRES and ATOM records:

>d2zxab2 b.71.1.0 (B:357-448) automated matches {Thermotoga maritima [TaxId: 2336]}
gtsvwerccaktedgteirftrkcnrifviflgiptgekiviedlnlsagtvrhfltger
lsfknvgknleitvpkklletdsitlvleave

Timeline for d2zxab2:

• d2zxab2 is new in SCOPe 2.04-stable
  
• d2zxab2 appears in SCOPe 2.05
  
• d2zxab2 appears in the current release, SCOPe 2.08