Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.11: Putative alpha-L-fucosidase, catalytic domain [102079] (2 proteins) glycosyl hydrolase family 29; contains additional beta-barrel with a topological similarity to the C-terminal domain of alpha amylases automatically mapped to Pfam PF01120 |
Protein automated matches [231482] (2 species) not a true protein |
Species Thermotoga maritima [TaxId:2336] [231744] (10 PDB entries) |
Domain d2zxaa1: 2zxa A:7-356 [245036] Other proteins in same PDB: d2zxaa2, d2zxaa3, d2zxab2, d2zxab3 automated match to d2zwyb1 complexed with zxa |
PDB Entry: 2zxa (more details), 2.57 Å
SCOPe Domain Sequences for d2zxaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zxaa1 c.1.8.11 (A:7-356) automated matches {Thermotoga maritima [TaxId: 2336]} rykpdweslrehtvpkwfdkakfgifihwgiysvpgwatptgelgkvpmdawffqnpyae wyenslrikesptweyhvktygenfeyekfadlftaekwdpqewadlfkkagakyviptt khhdgfclwgtkytdfnsvkrgpkrdlvgdlakavreaglrfgvyysggldwrfttepir ypedlsyirpntyeyadyaykqvmelvdlylpdvlwndmgwpekgkedlkylfayyynkh pegsvndrwgvphwdfktaeyhvnypgdlpgykweftrgiglsfgynrnegpehmlsveq lvytlvdvvskggnlllnvgpkgdgtipdlqkerllglgewlrkygdaiy
Timeline for d2zxaa1: