![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
![]() | Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
![]() | Family b.71.1.0: automated matches [227134] (1 protein) not a true family |
![]() | Protein automated matches [226835] (41 species) not a true protein |
![]() | Species Thermotoga maritima [TaxId:2336] [231746] (10 PDB entries) |
![]() | Domain d2zx9a2: 2zx9 A:357-447 [245033] Other proteins in same PDB: d2zx9a1, d2zx9a3, d2zx9b1, d2zx9b3 automated match to d2zwyb2 complexed with zx9 |
PDB Entry: 2zx9 (more details), 2.62 Å
SCOPe Domain Sequences for d2zx9a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zx9a2 b.71.1.0 (A:357-447) automated matches {Thermotoga maritima [TaxId: 2336]} gtsvwerccaktedgteirftrkcnrifviflgiptgekiviedlnlsagtvrhfltger lsfknvgknleitvpkklletdsitlvleav
Timeline for d2zx9a2: