| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
| Family c.1.8.11: Putative alpha-L-fucosidase, catalytic domain [102079] (2 proteins) glycosyl hydrolase family 29; contains additional beta-barrel with a topological similarity to the C-terminal domain of alpha amylases automatically mapped to Pfam PF01120 |
| Protein automated matches [231482] (2 species) not a true protein |
| Species Thermotoga maritima [TaxId:2336] [231744] (10 PDB entries) |
| Domain d2zx8b1: 2zx8 B:7-356 [245030] Other proteins in same PDB: d2zx8a2, d2zx8b2 automated match to d2zwyb1 complexed with zx8 |
PDB Entry: 2zx8 (more details), 2.33 Å
SCOPe Domain Sequences for d2zx8b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zx8b1 c.1.8.11 (B:7-356) automated matches {Thermotoga maritima [TaxId: 2336]}
rykpdweslrehtvpkwfdkakfgifihwgiysvpgwatptgelgkvpmdawffqnpyae
wyenslrikesptweyhvktygenfeyekfadlftaekwdpqewadlfkkagakyviptt
khhdgfclwgtkytdfnsvkrgpkrdlvgdlakavreaglrfgvyysggldwrfttepir
ypedlsyirpntyeyadyaykqvmelvdlylpdvlwndmgwpekgkedlkylfayyynkh
pegsvndrwgvphwdfktaeyhvnypgdlpgykweftrgiglsfgynrnegpehmlsveq
lvytlvdvvskggnlllnvgpkgdgtipdlqkerllglgewlrkygdaiy
Timeline for d2zx8b1: