![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
![]() | Family c.1.8.11: Putative alpha-L-fucosidase, catalytic domain [102079] (2 proteins) glycosyl hydrolase family 29; contains additional beta-barrel with a topological similarity to the C-terminal domain of alpha amylases automatically mapped to Pfam PF01120 |
![]() | Protein automated matches [231482] (2 species) not a true protein |
![]() | Species Thermotoga maritima [TaxId:2336] [231744] (10 PDB entries) |
![]() | Domain d2zx7b1: 2zx7 B:7-356 [245026] Other proteins in same PDB: d2zx7a2, d2zx7a3, d2zx7b2, d2zx7b3 automated match to d2zwyb1 complexed with zx7 |
PDB Entry: 2zx7 (more details), 2.48 Å
SCOPe Domain Sequences for d2zx7b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zx7b1 c.1.8.11 (B:7-356) automated matches {Thermotoga maritima [TaxId: 2336]} rykpdweslrehtvpkwfdkakfgifihwgiysvpgwatptgelgkvpmdawffqnpyae wyenslrikesptweyhvktygenfeyekfadlftaekwdpqewadlfkkagakyviptt khhdgfclwgtkytdfnsvkrgpkrdlvgdlakavreaglrfgvyysggldwrfttepir ypedlsyirpntyeyadyaykqvmelvdlylpdvlwndmgwpekgkedlkylfayyynkh pegsvndrwgvphwdfktaeyhvnypgdlpgykweftrgiglsfgynrnegpehmlsveq lvytlvdvvskggnlllnvgpkgdgtipdlqkerllglgewlrkygdaiy
Timeline for d2zx7b1: