Lineage for d2zwkc2 (2zwk C:95-188)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2234637Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2234638Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2235412Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 2235413Protein automated matches [190159] (16 species)
    not a true protein
  7. 2235451Species Escherichia coli [TaxId:155864] [255736] (1 PDB entry)
  8. 2235452Domain d2zwkc2: 2zwk C:95-188 [245013]
    Other proteins in same PDB: d2zwka1, d2zwkc1, d2zwke1
    automated match to d2zqka2

Details for d2zwkc2

PDB Entry: 2zwk (more details), 3.1 Å

PDB Description: Crystal structure of intimin-Tir90 complex
PDB Compounds: (C:) intimin

SCOPe Domain Sequences for d2zwkc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zwkc2 d.169.1.0 (C:95-188) automated matches {Escherichia coli [TaxId: 155864]}
ymikvdkqayyadamsicknllpstqtvlsdiydswgaankyshyssmnsitawikqtss
eqrsgvsstynlitqnplpgvnvntpnvyavcve

SCOPe Domain Coordinates for d2zwkc2:

Click to download the PDB-style file with coordinates for d2zwkc2.
(The format of our PDB-style files is described here.)

Timeline for d2zwkc2: