Lineage for d2zwka2 (2zwk A:95-188)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1682071Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1682072Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1682776Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 1682777Protein automated matches [190159] (12 species)
    not a true protein
  7. 1682821Species Escherichia coli [TaxId:83334] [231724] (2 PDB entries)
  8. 1682824Domain d2zwka2: 2zwk A:95-188 [245011]
    Other proteins in same PDB: d2zwka1, d2zwkc1, d2zwke1
    automated match to d2zqka2

Details for d2zwka2

PDB Entry: 2zwk (more details), 3.1 Å

PDB Description: Crystal structure of intimin-Tir90 complex
PDB Compounds: (A:) intimin

SCOPe Domain Sequences for d2zwka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zwka2 d.169.1.0 (A:95-188) automated matches {Escherichia coli [TaxId: 83334]}
ymikvdkqayyadamsicknllpstqtvlsdiydswgaankyshyssmnsitawikqtss
eqrsgvsstynlitqnplpgvnvntpnvyavcve

SCOPe Domain Coordinates for d2zwka2:

Click to download the PDB-style file with coordinates for d2zwka2.
(The format of our PDB-style files is described here.)

Timeline for d2zwka2: