Class a: All alpha proteins [46456] (285 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.0: automated matches [191396] (1 protein) not a true family |
Protein automated matches [190513] (24 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189519] (37 PDB entries) |
Domain d2zrsf_: 2zrs F: [244982] automated match to d3aaja_ complexed with ca |
PDB Entry: 2zrs (more details), 3.1 Å
SCOPe Domain Sequences for d2zrsf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zrsf_ a.39.1.0 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]} sflwnvfqrvdkdrsgvisdtelqqalsngtwtpfnpvtvrsiismfdrenkagvnfsef tgvwkyitdwqnvfrtydrdnsgmidknelkqalsgfgyrlsdqfhdilirkfdrqgrgq iafddfiqgcivlqrltdifrrydtdqdgwiqvsyeqylsmvf
Timeline for d2zrsf_: