Lineage for d2zrsf_ (2zrs F:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1489461Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1489462Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1490700Family a.39.1.0: automated matches [191396] (1 protein)
    not a true family
  6. 1490701Protein automated matches [190513] (24 species)
    not a true protein
  7. 1490735Species Human (Homo sapiens) [TaxId:9606] [189519] (37 PDB entries)
  8. 1490770Domain d2zrsf_: 2zrs F: [244982]
    automated match to d3aaja_
    complexed with ca

Details for d2zrsf_

PDB Entry: 2zrs (more details), 3.1 Å

PDB Description: crystal structure of ca2+-bound form of des3-23alg-2
PDB Compounds: (F:) programmed cell death protein 6

SCOPe Domain Sequences for d2zrsf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zrsf_ a.39.1.0 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sflwnvfqrvdkdrsgvisdtelqqalsngtwtpfnpvtvrsiismfdrenkagvnfsef
tgvwkyitdwqnvfrtydrdnsgmidknelkqalsgfgyrlsdqfhdilirkfdrqgrgq
iafddfiqgcivlqrltdifrrydtdqdgwiqvsyeqylsmvf

SCOPe Domain Coordinates for d2zrsf_:

Click to download the PDB-style file with coordinates for d2zrsf_.
(The format of our PDB-style files is described here.)

Timeline for d2zrsf_: